admin

28.04.2020 Düşecek Domain Listesi

Merhaba, 28.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMduzikokultursuzgizlisifayasambankeczakargoforumbilgekartushanehelaltohumkursfirsatuzmankamerauygunhediyetoptanforumigdirpatentyozgatpatentburdurpatentbartinpatentsirnakpatentbatmanpatentbingolpatentbayburtpatentkaramanpatentcanakkalepatentuzakasistanozelroportajortakyatirimucretsizhostengelliolmakrobotbilisimguvenlikazanckazanmakkolaybilimselsozlukankarayasamkocuguncelalisverisyalovaambulansistanbulambulanseskisehiretkinlik NETtemekalinganameliyati (subdomain)forumbelgeyasalkayit ORGhangibankakonyataksi

Continue reading...

27.04.2020 Düşecek Domain Listesi

Merhaba, 27.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net uzantılı alan adları yer almaktadır. COMiltizameskicamisanaltestilimhaberkosuyorumtatlibebektopluaramaoyunreklamrizepatentkarspatentusakpatentbalikesirpatentkirklarelipatentmuglapatentkahramanmaraspatentantakyapatenthakkaripatentkutayhapatentosmaniyepatenticerikyonetimkariyersahibihurdaotomobilbodrumpostoyuncakistasyonuleziztariffiyatteklifankarasapkamanisaprefabriktoprakanaliz NETbicimfalsobozumaralikvelayetalbuminarabaresimotomobilcionayliyorumistanbulsaaterzincantaksiotomatikbegeni

Continue reading...

26.04.2020 Düşecek Domain Listesi

Merhaba, 26.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMdersforumuzmankuponsatilikofisgiresunspororganikforumproteinforumfethiyekiralik NETmuallakimamoglutercihleridealkiloturkcemuzikforumistanbultoptanayakkabi ORGkeyifli

Continue reading...

25.04.2020 Düşecek Domain Listesi

Merhaba, 25.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMkitapyayingazeterotaucuzbikiniuzayharitaanadolufilminegolajansizmirsozlukizmirustavizyontatilvizyonbiletdogruyontemsifrelikasauzmantercihmeraklisitesosyaldovizorganikolsunnaturelpazarizmitsigortasporekipmanimeshuryerlerhavaliminderyurdisibursorganikpeynirsureklikazancbitkiseleczaneuniversitebilgi NETdogumfotososyaladamyemekmagazin ORGcisimerotizmucuzgiyimucuzkartvizit

Continue reading...

24.04.2020 Düşecek Domain Listesi

Merhaba, 24.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMtablosaatizmitilancorluajanskonyakiralikprogramportalucuzkurbanlik NETtombakizotermdizihabersatilikdepoistanbulofisistanbulpansiyon ORGdarbeeyaletilmihal

Continue reading...

23.04.2020 Düşecek Domain Listesi

Merhaba, 23.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMinhisargirgirciictenlikskorbahistarimforumhazirmantiguvenlikilangebzemobilyaklasikhediyenostaljikhediye NETnesilbarajortadogueaglevideomarmarahukuk ORGsakaksevmek

Continue reading...

22.04.2020 Düşecek Domain Listesi

Merhaba, 22.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMduraklimecburiodevyeriilansaatiistiflemegizliozneyoksunlukuygunpaketaltinkemerbilgitoplauyguncihazmemurradyotalebeyurdumerkeziuygucentilmencetabletkilifitercumanburadateknolojiportalulusalegemenlikengelsizticaretbodrumhediyelik NETotopsidanismaeleskirtucuzpazarmanisataksi ORGortadogualtinparkresepsiyonyenimahalle

Continue reading...

21.04.2020 Düşecek Domain Listesi

Merhaba, 21.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMsanslimisinliderprojesondakikaciuzmanaskernaturalprojeozelindirimlerpsikolojilerkirlosgelismeksemerlisaathediye NETorganikgubrevergihabersiteyazilimparticibebekdevrinakitavanssosyalsepetkumanyaciparakart ORGkarahisar

Continue reading...

20.04.2020 Düşecek Domain Listesi

Merhaba, 20.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net uzantılı alan adları yer almaktadır. COMyontucuagaclikyesildepomavireyontasdiknamemarkasepetdiplomasizbursaradyodokuzcanlifirmaanketkentmagazinyesilsalatatatilreklammenzilhabergezginradyodavulmarketyesilgelecekucuzbisikletbozuyukhaberfikirdanismaniistanbulkemankursuistanbulpiyanokursu NETemtiakeskuldizihaneizmirhukukrenklikutucinselsoruntatilhediyerobotturkiyetransferhaberelektronikparaistanbulgitarkursu

Continue reading...

19.04.2020 Düşecek Domain Listesi

Merhaba, 19.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMgezigunuminireyonhazirbaskiortaklazimorguhediyetelefonbayikeseneuygungrafikstudyoforumtiryakikonsultasyonhelalsevgilibandirmaforumyalovatercumeadanaaksesuarsanalbelediyegezginhemsiredavetiyeantalyamutluluklistesi NETvapurpacozkomutdehlizzamburrencideviziltikuyucakkemalizmvideoseksvideomontajedirnekuaforistanbulmansetsakaryalojistik ORGpapak

Continue reading...