
08.05.2020 Düşecek Domain Listesi

08.05.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMzeejemlakurfaantikparahediyebabakonyakoltukyikama NETterkiebabilusulcamarabamigferoyunforumreaksiyonmevzubahisgecicidovmetorrentforum ORGsaatkulesikampusilan

Continue reading...

07.05.2020 Düşecek Domain Listesi

07.05.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMadilikmurteciarjantinyenikitapgenchatunsiteyapmaeskigarajcihanajansdizisohbetyenimahsuldiyetprogramemeklidoktororganikproteinkampusistanbulbilgisayarmagazin NETkerevetkalkanderesinemasaatigirisimkocusatilikdukkanistanbulkoltukyikama ORGkeyfimigfermuhabirgazisehiryesilirmak

Continue reading...

06.05.2020 Düşecek Domain Listesi

06.05.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMteennidiyetaramaizmirjigolokizilayotelkurthaberkunefemarketankarasiparis NETsiliktuzlukardesenpazartesiankaraperde ORGnezir

Continue reading...

05.05.2020 Düşecek Domain Listesi

05.05.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMerfysahremteskilsatafatbuyurabiiftariyemisillemeardahandanelazigilanvideoefektuygunhizmetvenusdizayn NETyengehapismudurmaraztaramabeylikrahibekalyonhususinevrozmahsuphamiyethergeleasgariucretcanlitahmin ORGplakakaraborsa

Continue reading...

04.05.2020 Düşecek Domain Listesi

04.05.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net uzantılı alan adları yer almaktadır. COMswozvfmvduzeckepekliilahiklipfikiryeriidealannesempatizanaktifmuziksosyeteforum NETCLLbuyulukekemehondaforumdijitalofistoptangumusmezopotamya

Continue reading...

03.05.2020 Düşecek Domain Listesi

03.05.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMvvbkiplkcpjdvcjgoznelsefaatminidunyaarabayeniyesilsitesanalimzabahcebankmarkanomiyenitatilbanasoyleodulplaketdizidublajilhamgeldikazatespitbambugiyimpanoreklamkomedihaberajansgazetetatilekstramaksatforumdidimkuaforsosyalyazartasarimcantadijitalcocukhayatguzelliksadecetiyatrootomobilajansdijitalacentesadecetiyatroankaraortopedi NETzeybekhadisenekamuflajbizedairarsatarlabebekicinbizedanisyasamhaberkapalikutuozelbakicitrasmakinesiakillimercekklasikotomobilteknolojiportal ORGdisciilginceskortaharhasanagaerotikmagazin

Continue reading...

02.05.2020 Düşecek Domain Listesi

Merhaba, 02.05.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net uzantılı alan adları yer almaktadır. COMphhwsxuswvhxbilerekozelsitefikirsiztekellummultefitrahatlamaeksigeyikkasifadamedebisohbetfirmavitrinbahisvizyondonanimgrupfotoekspressarkidinlemeseyyarmarkettekirdagkoftehediyesiparissiyasalgundemcorapmakinesikiralikantrepoankaramusavirlikuniversitesikayet NETkayinturbetartizevksuyuavonkayitoyunhabertasarimhanesatilikotelsatisdanismani

Continue reading...

01.05.2020 Düşecek Domain Listesi

Merhaba, 01.05.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMnukleeriktisadiyogakursustaanneilkelanneannekampusparaistemodaradyohalifelikuzaymuzikgemimaketkentilyonezanvakitparakulisbeyazucaknezihmekanhobihediyehazirparcaalangidiyorbelirsizlikhediyefikiristanbulrakidijitalmakaleyumurcakbebekhepsibilgisayarizmitdekorasyonsanliurfahaliyikama NETlaponcanlisiteparabankabizimtatilgaziantepajanstelevizyonhaber ORGsaolbutonmatuf

Continue reading...

30.04.2020 Düşecek Domain Listesi

Merhaba, 30.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMhamilemiunyehaberbasariyoluhaberpostaacilteklifdengesizimfikirlazimdolarpiyasatoprakhisarturkiyekursuykusuzhaberbeyazdavetiyekarikaturhanealternatifradyo NEThafikturappusetanilinmizikalatifeeksimayahazirkupon ORGkibritanahtarteslim

Continue reading...

29.04.2020 Düşecek Domain Listesi

Merhaba, 29.04.2020 tarihinde düşecek domain listesini sizler için derledim arkadaşlar. Sadece com – net – org uzantılı alan adları yer almaktadır. COMpsikozasabiyehaberulkupazarpazarkariyergunudoguekspresaltmisdokuzhediyecaddegorselradyomekantavsiyeherkesmemnunvincehliyetibitlispatentgeridonusumcumilliyethaberingilizceforumankarahidrolikherkeskazanacakmalatyakuruyemisorganiksertifikali NETavcilikgergedanahsapmasakisirdongugunlukyasamtelefondinlemetoplamabilgisayarankaramarkatescil ORGkonsulmaskaraucuzkirtasiye

Continue reading...